PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco015463.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family WOX
Protein Properties Length: 159aa    MW: 17218.1 Da    PI: 10.0394
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco015463.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.57.2e-2147106357
                  --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                  +R+++tkeq+ +Le l+++  r+psae++++++ kl     ++ ++V++WFqN++a++++
  Aco015463.1  47 SRWNPTKEQISILEGLYKQgIRTPSAEQIQQITGKLreygAIEGKNVFYWFQNHKARQRQ 106
                  7*****************99**************************************97 PP

2Wus_type_Homeobox118.33.3e-3846108365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RW+Pt+eQi iLe lyk+G+rtP++e+iq+it +L+eyG+ie+kNVfyWFQN+kaR+rqkq
        Aco015463.1  46 SSRWNPTKEQISILEGLYKQGIRTPSAEQIQQITGKLREYGAIEGKNVFYWFQNHKARQRQKQ 108
                        79***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.81942107IPR001356Homeobox domain
SuperFamilySSF466894.11E-1343114IPR009057Homeodomain-like
SMARTSM003891.5E-544111IPR001356Homeobox domain
PfamPF000461.2E-1847106IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.7E-847106IPR009057Homeodomain-like
CDDcd000864.05E-548108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MEEEAKISSS SPPPPASTTT TTTATPSSFA NTSSHANANA NASSGSSRWN PTKEQISILE  60
GLYKQGIRTP SAEQIQQITG KLREYGAIEG KNVFYWFQNH KARQRQKQKQ ETFAYFSRLL  120
HHATPPPPPP PLLQPQPLSP PPQSPSSLSH APPCTNST*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009381843.19e-48PREDICTED: WUSCHEL-related homeobox 5
SwissprotQ6X7K16e-47WOX2_ARATH; WUSCHEL-related homeobox 2
TrEMBLM0RLN15e-48M0RLN1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P26570_0011e-47(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75093548
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.12e-39WUSCHEL related homeobox 2